ARHGEF26

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017722

 

Antibody HPA049195

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017722 HPA049195 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

112 137 

Antigen sequence

PEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQ
KSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLAS
EIKISKSNNQNV
 
ESEVDNDVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVL
KVVMEDKEKFSSLGRIKKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDE
ESEPKEQKSDEKIVIHHKPLRSTWSQLSAVKRKGLSQ
 

Matching transcripts

ARHGEF26-001 - ENSP00000348828 [100%]
ARHGEF26-002 - ENSP00000423418 [100%]
ARHGEF26-003 - ENSP00000424446 [100%]
ARHGEF26-004 - ENSP00000423295 [100%]
 ARHGEF26-001 - ENSP00000348828 [100%]
ARHGEF26-002 - ENSP00000423418 [100%]
ARHGEF26-003 - ENSP00000424446 [100%]
ARHGEF26-004 - ENSP00000423295 [97%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells as well as in the muscular layers.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:20  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 1:115 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.3, 88.1, 48.2 97.3, 88.1, 48.2 

Antibody dilution

1:250 1:570 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:4550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF26-001
 
ARHGEF26-002
 
ARHGEF26-003
 
ARHGEF26-004