FOXP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003876

 

Antibody CAB011501

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA003876 ab16645 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

143  

Antigen sequence

QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVT
SAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTP
KRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
 
 

Matching transcripts

FOXP1-001 - ENSP00000318902 [100%]
FOXP1-002 - ENSP00000418524 [100%]
FOXP1-003 - ENSP00000333560 [100%]
FOXP1-004 - ENSP00000419393 [100%]
FOXP1-005 - ENSP00000417857 [100%]
FOXP1-006 - ENSP00000418102 [100%]
FOXP1-009 - ENSP00000418225 [100%]
FOXP1-011 - ENSP00000420736 [100%]
FOXP1-012 - ENSP00000418883 [100%]
FOXP1-021 - ENSP00000417941 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows moderate nuclear positivity in lymphoid cells outside reaction center.
More information
 Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:91 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.3, 75.3, 75.2, 68.1, 66.4, 64.0, 63.2, 25.4 76.3, 75.3, 75.2, 68.1, 66.4, 64.0, 63.2, 25.4, 14.3, 12.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FOXP1-001
 
FOXP1-002
 
FOXP1-003
 
FOXP1-004
 
FOXP1-005
 
FOXP1-006
 
FOXP1-009
 
FOXP1-011
 
FOXP1-012
 
FOXP1-021