ZAP70

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003134

 

Antibody CAB002625

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA003134 MS-1911 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

140  

Antigen sequence

LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPE
PARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELG
CGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
 
 

Matching transcripts

ZAP70-001 - ENSP00000264972 [100%]
ZAP70-201 - ENSP00000411141 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human appendix shows strong nuclear positivity in lymphoid tissue.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.9, 55.9 69.9, 55.9, 35.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ZAP70-001
 
ZAP70-201