ACTR3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047016

 

Antibody HPA051683

 

Antibody CAB005085

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA047016 HPA051683 sc-15390 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

38 40  

Antigen sequence

VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR
 
KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
 
 

Matching transcripts

ACTR3-001 - ENSP00000263238 [100%]
ACTR3-008 - ENSP00000444987 [100%]
ACTR3-201 - ENSP00000445257 [100%]
 ACTR3-001 - ENSP00000263238 [100%]
ACTR3-008 - ENSP00000444987 [100%]
ACTR3-201 - ENSP00000445257 [83%]
  

Other gene match

ACTR3B - ENSG00000133627 [95%]
 ACTR3B - ENSG00000133627 [95%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows distinct cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:150 1:35 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

47.6, 47.4, 42.0, 40.8, 37.9 47.6, 47.4, 42.0, 40.8, 39.7 47.4, 42.0, 40.8, 4.4, 3.6, 1.9 

Antibody dilution

1:500 1:150 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:4000 1:1200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACTR3-001
 
ACTR3-008
 
ACTR3-201