ACVR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007505

 

Antibody HPA046514

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007505 HPA046514 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

62 100 

Antigen sequence

RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLV
QRTVARQITLLE
 
EKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQV
YEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
 

Matching transcripts

ACVR1-001 - ENSP00000263640 [100%]
ACVR1-003 - ENSP00000387273 [100%]
ACVR1-009 - ENSP00000387127 [100%]
ACVR1-201 - ENSP00000405004 [100%]
 ACVR1-001 - ENSP00000263640 [100%]
ACVR1-003 - ENSP00000387273 [100%]
ACVR1-009 - ENSP00000387127 [100%]
ACVR1-201 - ENSP00000405004 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:15  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.2 57.2 

Antibody dilution

1:250 1:150 

Validation WB

Uncertain: No bands detected Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

 1:31 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ACVR1-001
 
ACVR1-003
 
ACVR1-009
 
ACVR1-201