GRB14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035052

 

Antibody CAB022294

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA035052 MAB1167 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

70  

Antigen sequence

KEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKM
LCAEEEQSRTCWVTAIRLLK
 
 

Matching transcripts

GRB14-001 - ENSP00000263915 [100%]
GRB14-002 - ENSP00000416786 [100%]
GRB14-201 - ENSP00000443699 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:15 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.0, 51.9, 47.6 61.0, 51.9, 47.6, 18.3 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-549 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:5  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GRB14-001
 
GRB14-002
 
GRB14-201