FANCL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036685

 

Antibody HPA036686

 

Antibody CAB033842

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA036685 HPA036686 sc-66887 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 7 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

81 76  

Antigen sequence

ALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDA
SGREHLITLKLKAKYPAESPDYFVDFPVPFC
 
FPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEW
LRGLLTSRQSFNIIFGECPYCSKPIT
 
 

Matching transcripts

FANCL-001 - ENSP00000233741 [100%]
FANCL-002 - ENSP00000385021 [100%]
FANCL-003 - ENSP00000401280 [100%]
FANCL-004 - ENSP00000386097 [100%]
FANCL-009 - ENSP00000400969 [100%]
 FANCL-001 - ENSP00000233741 [100%]
FANCL-002 - ENSP00000385021 [100%]
FANCL-004 - ENSP00000386097 [100%]
FANCL-006 - ENSP00000384046 [100%]
FANCL-003 - ENSP00000401280 [91%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:15 1:500 1:75 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line A-431 shows positivity in Golgi apparatus, intermediate filaments, microtubules & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

  1:19 

Validation IF

  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413350)
More information
  

Target mass (kDa)

43.4, 42.9, 39.8, 34.1, 32.7 43.4, 42.9, 39.8, 34.1, 29.4 43.4, 42.9, 39.8, 34.1, 32.7, 29.4, 17.9, 16.4, 14.7 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FANCL-001
 
FANCL-002
 
FANCL-003
 
FANCL-004
 
FANCL-006
 
FANCL-009