STAT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000931

 

Antibody HPA000982

 

Antibody CAB004049

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA000931 HPA000982 9175 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

137 143  

Antigen sequence

FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELD
SKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQK
QEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
 
LLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIR
NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGT
GYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVE
 
 

Matching transcripts

STAT1-001 - ENSP00000354394 [100%]
STAT1-002 - ENSP00000376137 [100%]
STAT1-003 - ENSP00000376136 [100%]
STAT1-011 - ENSP00000386244 [100%]
 STAT1-001 - ENSP00000354394 [100%]
STAT1-011 - ENSP00000386244 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human urinary bladder shows strong nuclear and cytoplasmic positivity in urothelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
More information
 Immunohistochemical staining of human liver shows membrane positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:500 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
  

Antibody dilution

1:45 1:61  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

87.3, 83.4, 83.0 87.3 87.3, 83.4, 83.0, 23.1, 21.8, 18.1, 8.6, 6.4, 4.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000 1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
STAT1-001
 
STAT1-002
 
STAT1-003
 
STAT1-011