MOB4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044125

 

Antibody CAB034082

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA044125 sc-80664 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

77  

Antigen sequence

RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDY
TRHTLDGAACLLNSNKYFPSRVSIKES
 
 

Matching transcripts

MOB4-001 - ENSP00000315702 [100%]
MOB4-002 - ENSP00000233892 [100%]
MOB4-006 - ENSP00000405354 [100%]
MOB4-008 - ENSP00000387289 [100%]
  

Other gene match

HSPE1-MOB4 - ENSG00000270757 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:1000 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404580)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

29.7, 26.0, 23.5, 22.3 26.0, 23.5, 22.3, 14.6, 5.6, 5.1 

Antibody dilution

1:125 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MOB4-001
 
MOB4-002
 
MOB4-006
 
MOB4-008