DARS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020451

 

Antibody HPA029804

 

Antibody HPA029805

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020451 HPA029804 HPA029805 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

125 112 135 

Antigen sequence

LHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVID
LRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFT
VSYFKNNAYLAQSPQLYKQMCICAD
 
AEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQT
EIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNE
KLLGHLVKEKYD
 
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRD
LTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQ
MVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDV
 

Matching transcripts

DARS-001 - ENSP00000264161 [100%]
DARS-201 - ENSP00000444192 [100%]
 DARS-001 - ENSP00000264161 [100%]
DARS-201 - ENSP00000444192 [100%]
DARS-009 - ENSP00000387508 [87%]
 DARS-001 - ENSP00000264161 [100%]
DARS-005 - ENSP00000404445 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:75 1:15 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:20   

Validation IF

Supportive: The subcellular location is supported by literature.   

         siRNA

Image

   

Description

Signal downregulation > 25% by one siRNA.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:25   

Validation siRNA

Supportive: The siRNA validation is supportive.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.1, 45.8 57.1, 45.8, 21.6 57.1, 20.0 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
DARS-001
 
DARS-005
 
DARS-009
 
DARS-201