NPHS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049486

 

Antibody CAB037267

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA049486 P0372 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

78  

Antigen sequence

KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLN
CLSSPSNRTQGSLPFPSPSKPVEPLNPK
 
 

Matching transcripts

NPHS2-001 - ENSP00000356587 [100%]
NPHS2-002 - ENSP00000356588 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong membrane positivity in cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:6000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.2, 34.4 42.2, 34.4 

Antibody dilution

1:680 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:5400  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NPHS2-001
 
NPHS2-002