MECR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022018

 

Antibody HPA022030

 

Antibody HPA028740

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022018 HPA022030 HPA028740 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

111 110 106 

Antigen sequence

SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQI
AAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKD
MPQPRLALNCV
 
VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQG
NYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEA
VFSEEALIQV
 
SSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKK
DHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISS
KQILTM
 

Matching transcripts

MECR-001 - ENSP00000263702 [100%]
MECR-002 - ENSP00000362896 [100%]
MECR-006 - ENSP00000436831 [100%]
 MECR-001 - ENSP00000263702 [99%]
 MECR-001 - ENSP00000263702 [100%]
MECR-002 - ENSP00000362896 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human rectum shows distinct positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:125 1:40 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

40.5, 32.2, 22.9 40.5 40.5, 32.2 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 

Antibody dilution

  1:20 

Validation IF

  Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
MECR-001
 
MECR-002
 
MECR-006