ASH1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004806

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004806 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

148 

Antigen sequence

PPSPSFTTPLPPPSYMHAGHLLLNPAKYHKKKHKLLRQEAFLTTSRTPLL
SMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVL
ESLKRYRFGKDAVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHR
 

Matching transcripts

ASH1L-001 - ENSP00000357330 [100%]
ASH1L-002 - ENSP00000376204 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:43 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

332.8, 332.2 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ASH1L-001
 
ASH1L-002