AGMAT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026443

 

Antibody HPA028321

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026443 HPA028321 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

100 72 

Antigen sequence

MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAG
CIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
 
RRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSL
VPLMGEVRQQMGGKPIYISFDI
 

Matching transcripts

AGMAT-001 - ENSP00000364986 [100%]
 AGMAT-001 - ENSP00000364986 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:10 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411072)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.7 37.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AGMAT-001