SDHB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002867

 

Antibody HPA002868

 

Antibody CAB009822

 

Antibody CAB068233

 

Antibody CAB068234

 

Antibody CAB068235

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA002867 HPA002868 sc-25851 AMAb90705 AMAb90706 AMAb90708 

Host species

Rabbit Rabbit Rabbit Mouse Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G Protein A/G 

Released in version

3 3 4 13 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

147 109     

Antigen sequence

VVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAG
DKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAM
NINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQY
 
EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQ
AYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIA
EIKKMMATY
 
 
 
 
 

Matching transcripts

SDHB-001 - ENSP00000364649 [100%]
 SDHB-001 - ENSP00000364649 [100%]
     

Other gene match

      

ANTIBODY VALIDATION

         Immunofluorescence

Image

      

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:34      

Validation IF

Supportive: The subcellular location is supported by literature.      

         Western Blot

Image

      

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

31.6 31.6 31.6 31.6 31.6 31.6 

Antibody dilution

1:250 1:250 1:500 1:1000 1:1000 1:1000 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

      

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:3000     

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).     

         Immunohistochemistry

Image

      

Description

Application not done for this antibody. Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human liver shows strong positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human kidney shows strong positivity.
More information
 

Retrieval method

 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

 1:250 1:100 1:500 1:500 1:1400 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
SDHB-001