CDK18

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045429

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045429 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

81 

Antigen sequence

MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGR
DPPQECSTFSPTDSGEEPGQLSPGVQFQRRQ
 

Matching transcripts

CDK18-001 - ENSP00000353176 [100%]
CDK18-003 - ENSP00000399082 [100%]
CDK18-006 - ENSP00000423665 [100%]
CDK18-007 - ENSP00000391324 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human vulva/anal skin shows strong cytoplasmic positivity in basal layer of epidermal cells and endothelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.6, 54.4, 32.5 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CDK18-001
 
CDK18-003
 
CDK18-006
 
CDK18-007