ECE1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001490

 

Antibody HPA013616

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001490 HPA013616 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

131 147 

Antigen sequence

IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWS
MTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHEL
THAFDDQGREYDKDGNLRPWWKNSSVEAFKR
 
NEKVLTGYLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEK
RRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEINESEPIVVYDKE
YLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
 

Matching transcripts

ECE1-001 - ENSP00000405088 [100%]
ECE1-002 - ENSP00000364028 [100%]
ECE1-005 - ENSP00000349581 [100%]
ECE1-006 - ENSP00000264205 [100%]
ECE1-008 - ENSP00000388439 [100%]
 ECE1-001 - ENSP00000405088 [100%]
ECE1-002 - ENSP00000364028 [100%]
ECE1-005 - ENSP00000349581 [100%]
ECE1-006 - ENSP00000264205 [100%]
ECE1-008 - ENSP00000388439 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells and cytoplasm of endothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:80 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

87.2, 87.0, 85.8, 85.6, 83.6 87.2, 87.0, 85.8, 85.6, 83.6 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ECE1-001
 
ECE1-002
 
ECE1-005
 
ECE1-006
 
ECE1-008