AKR1A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017919

 

Antibody HPA019649

 

Antibody HPA027734

 

Antibody CAB006246

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA017919 HPA019649 HPA027734 H00010327-M01 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 5 6 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

80 77 99  

Antigen sequence

KYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWN
TKHHPEDVEPALRKTLADLQLEYLDLYLMH
 
NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDI
LSVASVRPAVLQVECHPYLAQNELIAH
 
PDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQ
NIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF
 
 

Matching transcripts

AKR1A1-001 - ENSP00000361140 [100%]
AKR1A1-002 - ENSP00000312606 [100%]
AKR1A1-004 - ENSP00000398414 [100%]
 AKR1A1-001 - ENSP00000361140 [100%]
AKR1A1-002 - ENSP00000312606 [100%]
 AKR1A1-001 - ENSP00000361140 [100%]
AKR1A1-002 - ENSP00000312606 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity both in exocrine glandular cells and islet cells.
More information
 Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:90 1:450 1:250 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 

Antibody dilution

1:16 1:100 1:50 1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401826)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.6, 16.5 36.6 36.6 36.6, 16.5 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000 1:6000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AKR1A1-001
 
AKR1A1-002
 
AKR1A1-004