PIK3R3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005751

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005751 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

84 

Antigen sequence

NVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKP
DGAFLIRESSKKGCYACSVVADGEVKHCVIYSTA
 

Matching transcripts

PIK3R3-001 - ENSP00000262741 [100%]
PIK3R3-002 - ENSP00000361075 [100%]
PIK3R3-004 - ENSP00000391431 [100%]
PIK3R3-201 - ENSP00000342484 [100%]
PIK3R3-202 - ENSP00000346188 [100%]
PIK3R3-203 - ENSP00000412546 [100%]
PIK3R3-204 - ENSP00000439913 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & intermediate filaments.
More information
 

Antibody dilution

1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401202)
More information
 

Target mass (kDa)

59.4, 54.4, 47.3, 43.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PIK3R3-001
 
PIK3R3-002
 
PIK3R3-004
 
PIK3R3-201
 
PIK3R3-202
 
PIK3R3-203
 
PIK3R3-204