ABCD3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA032026

 

Antibody HPA032027

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA032026 HPA032027 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

65 55 

Antigen sequence

MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDL
NFEVRSGANVLICGP
 
VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDT
VEFGS
 

Matching transcripts

ABCD3-001 - ENSP00000359233 [100%]
ABCD3-201 - ENSP00000377780 [100%]
ABCD3-202 - ENSP00000403357 [100%]
ABCD3-203 - ENSP00000440692 [100%]
 ABCD3-001 - ENSP00000359233 [100%]
ABCD3-201 - ENSP00000377780 [100%]
ABCD3-202 - ENSP00000403357 [100%]
ABCD3-203 - ENSP00000440692 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:78 1:35 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

78.4, 75.5, 67.3, 62.7 78.4, 75.5, 67.3, 62.7 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ABCD3-001
 
ABCD3-201
 
ABCD3-202
 
ABCD3-203