NEK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047522

 

Antibody CAB017530

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA047522 sc-55601 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

76  

Antigen sequence

FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN
PLIADLVADEQRRNLERRGRQLGEPE
 
 

Matching transcripts

NEK2-001 - ENSP00000355966 [100%]
NEK2-002 - ENSP00000355965 [100%]
NEK2-201 - ENSP00000440237 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human testis shows strong positivity in spermatids.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:250 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & cytokinetic bridge.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 

Antibody dilution

1:102 1:62 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.8, 46.8, 44.9 51.8, 46.8, 44.9 

Antibody dilution

1:510 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:4100  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NEK2-001
 
NEK2-002
 
NEK2-201