CTSD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003001

 

Antibody CAB000109

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA003001 MAB422 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

148  

Antigen sequence

LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLS
QDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMA
YPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
 
 

Matching transcripts

CTSD-001 - ENSP00000236671 [100%]
CTSD-005 - ENSP00000415036 [100%]
CTSD-006 - ENSP00000404902 [100%]
CTSD-002 - ENSP00000356164 [89%]
  

Other gene match

RP11-295K3.1 - ENSG00000250644 [81%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity with granular pattern in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:750 1:5 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

44.6, 40.3, 32.6, 30.0, 21.5 44.6, 32.6, 30.0, 21.5, 20.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CTSD-001
 
CTSD-002
 
CTSD-005
 
CTSD-006