DDX59

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047166

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA047166 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

81 

Antigen sequence

VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSI
EQLASQLLHNPVRIITGEKNLPCANVRQIIL
 

Matching transcripts

DDX59-001 - ENSP00000394367 [100%]
DDX59-002 - ENSP00000330460 [100%]
DDX59-201 - ENSP00000356317 [100%]
DDX59-005 - ENSP00000398152 [80%]
DDX59-006 - ENSP00000409954 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1500 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in actin filaments.
More information
 

Antibody dilution

1:135 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422174)
More information
 

Target mass (kDa)

68.8, 64.6, 62.8, 25.0, 8.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5400 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
DDX59-001
 
DDX59-002
 
DDX59-005
 
DDX59-006
 
DDX59-201