CREB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019150

 

Antibody CAB003803

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA019150 1496-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

5 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

101  

Antigen sequence

STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIE
EEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQ
G
 
 

Matching transcripts

CREB1-001 - ENSP00000387699 [100%]
CREB1-002 - ENSP00000236995 [100%]
CREB1-003 - ENSP00000405539 [100%]
CREB1-011 - ENSP00000405711 [100%]
CREB1-014 - ENSP00000412016 [100%]
CREB1-202 - ENSP00000445892 [100%]
CREB1-007 - ENSP00000403678 [80%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:500 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:91 1:125 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

36.7, 35.1, 26.7, 24.7, 19.2, 18.0 36.7, 35.1, 26.7, 25.4, 24.7, 19.5, 19.2, 18.0, 16.6, 14.7, 14.1, 14.0, 8.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CREB1-001
 
CREB1-002
 
CREB1-003
 
CREB1-007
 
CREB1-011
 
CREB1-014
 
CREB1-202