ADGB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036340

 

Antibody HPA036341

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036340 HPA036341 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

97 88 

Antigen sequence

DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIY
IFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR
 
IELPPSLKIYSWKRPQDILFSQTPVVVKNEITFDLFSANEHLLCSELMRW
IISEIYAVWKIFNGGILSNYFKGTSGEPPLLPWKPWEH
 

Matching transcripts

ADGB-001 - ENSP00000429315 [100%]
ADGB-009 - ENSP00000381036 [100%]
ADGB-202 - ENSP00000356463 [100%]
 ADGB-007 - ENSP00000430244 [100%]
ADGB-009 - ENSP00000381036 [100%]
ADGB-011 - ENSP00000428035 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

1:44 1:41 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

189.7, 81.6 189.7, 25.2, 20.4 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:350 

Validation IH

 Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ADGB-001
 
ADGB-007
 
ADGB-009
 
ADGB-011
 
ADGB-202