SLC16A7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005911

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005911 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
 

Matching transcripts

SLC16A7-001 - ENSP00000261187 [100%]
SLC16A7-002 - ENSP00000449547 [100%]
SLC16A7-003 - ENSP00000448071 [100%]
SLC16A7-004 - ENSP00000448742 [100%]
SLC16A7-005 - ENSP00000446722 [100%]
SLC16A7-010 - ENSP00000447814 [100%]
SLC16A7-201 - ENSP00000443731 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401493)
More information
 

Target mass (kDa)

52.2, 47.3, 41.7, 14.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC16A7-001
 
SLC16A7-002
 
SLC16A7-003
 
SLC16A7-004
 
SLC16A7-005
 
SLC16A7-010
 
SLC16A7-201