PKD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015794

 

Antibody HPA055297

 

Antibody CAB004544

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA015794 HPA055297 sc-28331 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

142 86  

Antigen sequence

REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVS
YEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLL
DGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
 
VKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKL
NFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTE
 
 

Matching transcripts

PKD2-001 - ENSP00000237596 [100%]
PKD2-002 - ENSP00000427131 [100%]
PKD2-005 - ENSP00000425289 [100%]
 PKD2-001 - ENSP00000237596 [100%]
PKD2-002 - ENSP00000427131 [100%]
PKD2-005 - ENSP00000425289 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows positivity in a subset of renal tubules.
More information
  Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubule.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:15  1:75 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

   

Target mass (kDa)

109.7, 43.9  109.7, 43.9 

Antibody dilution

1:250  1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size  Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:20000 1:11950  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

 1:200  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 
PKD2-001
 
PKD2-002
 
PKD2-005