TRPM6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007037

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007037 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

111 

Antigen sequence

LPTLSCTPEPMTMSSPLSQAKIMQTGGGYVNWAFSEGDETGVFSIKKKWQ
TCLPSTCDSDSSRSEQHQKQAQDSSLSDNSTRSAQSSECSEVGPWLQPNT
SFWINPLRRYR
 

Matching transcripts

TRPM6-001 - ENSP00000354006 [100%]
TRPM6-201 - ENSP00000354962 [100%]
TRPM6-202 - ENSP00000366060 [100%]
TRPM6-205 - ENSP00000396672 [100%]
TRPM6-206 - ENSP00000407341 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

232.2, 231.7, 231.0, 223.6 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TRPM6-001
 
TRPM6-201
 
TRPM6-202
 
TRPM6-205
 
TRPM6-206