NPC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000835

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000835 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

130 

Antigen sequence

PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSS
KAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIVSH
 

Matching transcripts

NPC2-001 - ENSP00000451112 [100%]
NPC2-006 - ENSP00000451180 [99%]
NPC2-007 - ENSP00000451206 [99%]
NPC2-003 - ENSP00000412103 [98%]
NPC2-008 - ENSP00000238633 [96%]
NPC2-004 - ENSP00000450502 [95%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:350 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: U-138 MG
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

23.7, 22.4, 19.2, 19.1, 16.6, 16.2 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NPC2-001
 
NPC2-003
 
NPC2-004
 
NPC2-006
 
NPC2-007
 
NPC2-008