SLC17A5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044479

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044479 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

44 

Antigen sequence

DMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQG
 

Matching transcripts

SLC17A5-001 - ENSP00000348019 [100%]
SLC17A5-201 - ENSP00000376742 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human thyroid gland shows weak cytoplasmic positivity in glandular cells along with distinctly stained extracellular material/ colloid.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:9 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.6, 19.5 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC17A5-001
 
SLC17A5-201