ACAT2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025736

 

Antibody HPA025765

 

Antibody HPA025811

 

Antibody CAB021106

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 GenWay Biotech
 

Product name

HPA025736 HPA025765 HPA025811 15-288-22016 

Host species

Rabbit Rabbit Rabbit Hen 

Clonality

pAb pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

70 81 70  

Antigen sequence

LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGIN
DGAAAVVLMKKSEADKRGLT
 
SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDA
FHNCHMGITAENVAKKWQVSREDQDKVAVLS
 
IIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCG
QNPVRQASVGAGIPYSVPAW
 
 

Matching transcripts

ACAT2-001 - ENSP00000356015 [100%]
ACAT2-201 - ENSP00000437850 [100%]
 ACAT2-001 - ENSP00000356015 [100%]
ACAT2-201 - ENSP00000437850 [100%]
 ACAT2-001 - ENSP00000356015 [100%]
ACAT2-201 - ENSP00000437850 [96%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells.
More information
 Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:45 1:65 1:10 1:12000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

44.6, 41.4 44.6, 41.4 44.6, 41.4 44.6, 41.4 

Antibody dilution

1:250 1:250 1:250 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
    

Antibody dilution

1:10    

Validation IF

Supportive: The subcellular location is supported by literature.    

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACAT2-001
 
ACAT2-201