CLU

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000572

 

Antibody CAB000476

 

Antibody CAB016253

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 Santa Cruz Biotechnology
 

Product name

HPA000572 AB825 sc-32264 

Host species

Rabbit Goat Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

2 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known 

Length (aa)

109   

Antigen sequence

SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFS
PYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRT
VCREIRHNS
 
 
 

Matching transcripts

CLU-001 - ENSP00000315130 [100%]
CLU-003 - ENSP00000429620 [100%]
CLU-004 - ENSP00000385419 [100%]
CLU-020 - ENSP00000430821 [100%]
CLU-201 - ENSP00000446413 [100%]
CLU-202 - ENSP00000453939 [100%]
CLU-002 - ENSP00000453247 [94%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human tonsil shows strong positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human tonsil shows strong positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:400 1:35 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: U-138 MG
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.8, 53.6, 52.5, 34.7, 33.4 57.8, 53.6, 52.5, 34.7, 33.4, 31.5, 23.7, 16.1, 15.8, 15.4, 14.8, 9.3, 3.6 57.8, 53.6, 52.5, 34.7, 33.4, 31.5, 23.7, 16.1, 15.8, 15.4, 14.8, 9.3, 3.6 

Antibody dilution

1:500 1:5000 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:1000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

  1:9 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
CLU-001
 
CLU-002
 
CLU-003
 
CLU-004
 
CLU-020
 
CLU-201
 
CLU-202