ADCY7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048241

 

Antibody HPA048474

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA048241 HPA048474 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 63 

Antigen sequence

PFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSY
DDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFL
 
TEATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQH
LPRPKGDAALKMR
 

Matching transcripts

ADCY7-001 - ENSP00000378187 [100%]
ADCY7-002 - ENSP00000457409 [100%]
ADCY7-201 - ENSP00000254235 [100%]
ADCY7-203 - ENSP00000445046 [100%]
 ADCY7-001 - ENSP00000378187 [100%]
ADCY7-002 - ENSP00000457409 [100%]
ADCY7-004 - ENSP00000455670 [100%]
ADCY7-201 - ENSP00000254235 [100%]
ADCY7-203 - ENSP00000445046 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:700  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

120.3, 81.5 120.3, 81.5, 59.0 

Antibody dilution

1:1190 1:80 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:9500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

 1:4 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ADCY7-001
 
ADCY7-002
 
ADCY7-004
 
ADCY7-201
 
ADCY7-203