A1BG

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044252

 

Antibody CAB016673

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA044252 LF-MA0185 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Ammonium Sulfate Precipitation 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

89  

Antigen sequence

SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLT
GDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM
 
 

Matching transcripts

A1BG-001 - ENSP00000263100 [99%]
A1BG-004 - ENSP00000470909 [85%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows positivity in plasma.
More information
 Immunohistochemical staining of human kidney shows positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

 1:25 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.3, 33.5 54.3, 33.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
A1BG-001
 
A1BG-004