CAT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055838

 

Antibody CAB001515

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 GeneTex
 

Product name

HPA055838 GTX21877 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

87  

Antigen sequence

NTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNF
TEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHL
 
 

Matching transcripts

CAT-001 - ENSP00000241052 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:16000 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line PC-3 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 

Antibody dilution

1:55 1:2000 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.8 59.8 

Antibody dilution

1:270 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CAT-001