BAI2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052612

 

Antibody HPA054617

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052612 HPA054617 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

77 87 

Antigen sequence

CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQ
LDLTWLRPTEPGSEGDYMVLPRRTLSL
 
RVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDW
DTENCQTLETQAAHTRCQCQHLSTFAVLAQPPKDLTL
 

Matching transcripts

BAI2-001 - ENSP00000362759 [100%]
BAI2-006 - ENSP00000381564 [100%]
BAI2-008 - ENSP00000381550 [100%]
BAI2-009 - ENSP00000381555 [100%]
BAI2-010 - ENSP00000381548 [100%]
BAI2-014 - ENSP00000435397 [100%]
BAI2-015 - ENSP00000362762 [100%]
BAI2-201 - ENSP00000257070 [100%]
BAI2-202 - ENSP00000391071 [100%]
 BAI2-001 - ENSP00000362759 [100%]
BAI2-006 - ENSP00000381564 [100%]
BAI2-008 - ENSP00000381550 [100%]
BAI2-009 - ENSP00000381555 [100%]
BAI2-010 - ENSP00000381548 [100%]
BAI2-014 - ENSP00000435397 [100%]
BAI2-015 - ENSP00000362762 [100%]
BAI2-201 - ENSP00000257070 [100%]
BAI2-202 - ENSP00000391071 [100%]
BAI2-007 - ENSP00000410921 [80%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in microtubule organizing center.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in microtubule organizing center.
More information
 

Antibody dilution

1:122 1:44 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

172.7, 172.5, 169.2, 163.8, 163.4, 159.9, 129.2 172.7, 172.5, 169.2, 163.8, 163.4, 159.9, 129.2, 92.0 

Antibody dilution

1:610 1:220 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4900 1:1750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BAI2-001
 
BAI2-006
 
BAI2-007
 
BAI2-008
 
BAI2-009
 
BAI2-010
 
BAI2-014
 
BAI2-015
 
BAI2-201
 
BAI2-202