MRPS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029487

 

Antibody HPA057261

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029487 HPA057261 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

70 90 

Antigen sequence

RWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHS
DFFNVKELFSVRSLFDARVH
 
IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCR
LFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
 

Matching transcripts

MRPS2-001 - ENSP00000360850 [100%]
MRPS2-007 - ENSP00000400082 [100%]
MRPS2-201 - ENSP00000241600 [100%]
 MRPS2-001 - ENSP00000360850 [100%]
MRPS2-201 - ENSP00000241600 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:45 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

33.2, 30.5 33.2 

Antibody dilution

1:250 1:120 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MRPS2-001
 
MRPS2-007
 
MRPS2-201