RBBP6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041725

 

Antibody HPA043544

 

Antibody CAB032866

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA041725 HPA043544 sc-25548 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

95 89  

Antigen sequence

KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPE
TQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD
 
TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGK
PASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE
 
 

Matching transcripts

RBBP6-001 - ENSP00000317872 [100%]
RBBP6-002 - ENSP00000316291 [100%]
RBBP6-005 - ENSP00000370427 [100%]
 RBBP6-001 - ENSP00000317872 [100%]
RBBP6-002 - ENSP00000316291 [100%]
RBBP6-005 - ENSP00000370427 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts while additional cytoplasmic staining in Leydig cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:500  1:100 

Literature conformity

Consistent with gene/protein characterization data  Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data  Not at all consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

201.6, 197.3, 106.0 201.6, 197.3, 106.0 201.6, 197.3, 113.5, 106.0, 33.0, 17.3, 13.2 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: No bands detected 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:200 1:34  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         siRNA

Image

   

Description

Signal downregulation > 25% by one siRNA.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:200   

Validation siRNA

Supportive: The siRNA validation is supportive.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RBBP6-001
 
RBBP6-002
 
RBBP6-005