ATP7B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013187

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA013187 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

144 

Antigen sequence

RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVA
PLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDG
MHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPV
 

Matching transcripts

ATP7B-002 - ENSP00000242839 [100%]
ATP7B-201 - ENSP00000342559 [100%]
ATP7B-203 - ENSP00000383221 [100%]
ATP7B-205 - ENSP00000393343 [100%]
ATP7B-206 - ENSP00000416738 [100%]
ATP7B-207 - ENSP00000443128 [100%]
ATP7B-202 - ENSP00000383217 [84%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:5 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

157.3, 150.5, 148.4, 145.8, 133.6, 110.3, 56.1 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATP7B-002
 
ATP7B-201
 
ATP7B-202
 
ATP7B-203
 
ATP7B-205
 
ATP7B-206
 
ATP7B-207