LRP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004182

 

Antibody HPA022903

 

Antibody CAB018621

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA004182 HPA022903 sc-19616 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

11 6 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

134 149  

Antigen sequence

STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCR
CTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVG
HCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
 
AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKA
QRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLG
CQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
 
 

Matching transcripts

LRP1-001 - ENSP00000243077 [100%]
 LRP1-001 - ENSP00000243077 [100%]
LRP1-002 - ENSP00000451449 [100%]
LRP1-003 - ENSP00000341264 [100%]
LRP1-004 - ENSP00000451737 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human hippocampus shows mdrate cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human kidney shows distinct cytoplasmic and membranous positivity in renal tubules.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:400 1:35 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

504.6 504.6, 48.2, 32.2, 31.6 504.6, 48.2, 32.2, 31.6, 20.6, 15.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
LRP1-001
 
LRP1-002
 
LRP1-003
 
LRP1-004