MORF4L2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031872

 

Antibody HPA054102

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031872 HPA054102 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 77 

Antigen sequence

QPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGR
WGGRSAENPPSGSVRKTRKNKQKTPGNGDGGS
 
MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN
LEPALPGRWGGRSAENPPSGSVRKTRK
 

Matching transcripts

MORF4L2-006 - ENSP00000400938 [100%]
MORF4L2-008 - ENSP00000413664 [100%]
MORF4L2-009 - ENSP00000393283 [100%]
MORF4L2-010 - ENSP00000391969 [100%]
MORF4L2-011 - ENSP00000353643 [100%]
MORF4L2-201 - ENSP00000394417 [100%]
MORF4L2-203 - ENSP00000415476 [100%]
MORF4L2-204 - ENSP00000410532 [100%]
 MORF4L2-006 - ENSP00000400938 [100%]
MORF4L2-008 - ENSP00000413664 [100%]
MORF4L2-009 - ENSP00000393283 [100%]
MORF4L2-010 - ENSP00000391969 [100%]
MORF4L2-011 - ENSP00000353643 [100%]
MORF4L2-201 - ENSP00000394417 [100%]
MORF4L2-203 - ENSP00000415476 [100%]
MORF4L2-204 - ENSP00000410532 [100%]
MORF4L2-007 - ENSP00000408607 [87%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells with additional cytoplasmic staining in endothelial cells and peripheral nerve/ganglion.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:750 

Literature conformity

 Consistent with gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:88 1:110 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         siRNA

Image

  

Description

Application not done for this antibody. Signal downregulation > 25% by both siRNA:s.
More information
 

Antibody dilution

 1:110 

Validation siRNA

 Supportive: The siRNA validation is supportive. 

         Western blot - siRNA

Image

  

Description

Application not done for this antibody. Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: Scrambled
More information
 

Target mass (kDa)

 32.3, 19.9, 19.8, 17.6, 7.3 

Loading control

 Total protein image 

Antibody dilution

 1:244 

Validation WB-siRNA

 Supportive: Downregulation visible in both siRNA lanes 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402188)
More information
 

Target mass (kDa)

32.3, 19.9, 19.8, 17.6 32.3, 19.9, 19.8, 17.6, 7.3 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:4400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MORF4L2-006
 
MORF4L2-007
 
MORF4L2-008
 
MORF4L2-009
 
MORF4L2-010
 
MORF4L2-011
 
MORF4L2-201
 
MORF4L2-203
 
MORF4L2-204