MORF4L2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054102

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA054102 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

77 

Antigen sequence

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN
LEPALPGRWGGRSAENPPSGSVRKTRK
 

Matching transcripts

MORF4L2-006 - ENSP00000400938 [100%]
MORF4L2-008 - ENSP00000413664 [100%]
MORF4L2-009 - ENSP00000393283 [100%]
MORF4L2-010 - ENSP00000391969 [100%]
MORF4L2-011 - ENSP00000353643 [100%]
MORF4L2-201 - ENSP00000394417 [100%]
MORF4L2-202 - ENSP00000416120 [100%]
MORF4L2-203 - ENSP00000415476 [100%]
MORF4L2-204 - ENSP00000410532 [100%]
MORF4L2-007 - ENSP00000408607 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells with additional cytoplasmic staining in endothelial cells and peripheral nerve/ganglion.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:750 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:110 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

32.3, 19.9, 19.8, 17.6, 7.3 

Antibody dilution

1:550 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MORF4L2-006
 
MORF4L2-007
 
MORF4L2-008
 
MORF4L2-009
 
MORF4L2-010
 
MORF4L2-011
 
MORF4L2-201
 
MORF4L2-202
 
MORF4L2-203
 
MORF4L2-204