EXOSC9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041838

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041838 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

76 

Antigen sequence

CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDE
VTLYTPEERDPVPLSIHHMPICVSFA
 

Matching transcripts

EXOSC9-001 - ENSP00000243498 [100%]
EXOSC9-003 - ENSP00000368984 [100%]
EXOSC9-005 - ENSP00000425782 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.
More information
 

Antibody dilution

1:8 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         GFP

Image

 

Description

Immunofluorescent staining of transgenic HeLa cells show antibody staining in nucleus & nucleoli and GFP expression in nucleus & nucleoli.
More information
 

Antibody dilution

1:8 

Validation IFGFP

Supportive: Antibody staining overlaps with GFP tagged protein 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.8, 48.9, 47.0 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EXOSC9-001
 
EXOSC9-003
 
EXOSC9-005