OBSL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036404

 

Antibody HPA036405

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036404 HPA036405 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 89 

Antigen sequence

NAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDAGE
VTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP
 
VRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQ
LEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVE
 

Matching transcripts

OBSL1-001 - ENSP00000362983 [100%]
OBSL1-002 - ENSP00000362980 [100%]
OBSL1-003 - ENSP00000289656 [100%]
OBSL1-014 - ENSP00000385636 [100%]
OBSL1-016 - ENSP00000474519 [100%]
OBSL1-202 - ENSP00000265318 [100%]
 OBSL1-014 - ENSP00000385636 [100%]
OBSL1-016 - ENSP00000474519 [100%]
OBSL1-202 - ENSP00000265318 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:20  

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

206.9, 197.1, 168.5, 153.0, 113.3, 68.1 206.9, 168.5, 153.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in centrosome.
More information
 

Antibody dilution

 1:92 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
OBSL1-001
 
OBSL1-002
 
OBSL1-003
 
OBSL1-014
 
OBSL1-016
 
OBSL1-202