NCOA3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024210

 

Antibody CAB009800

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA024210 sc-25742 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

131  

Antigen sequence

PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAEN
QRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSG
VSSSTSGGVSSTSNMHGSLLQEKHRILHKLL
 
 

Matching transcripts

NCOA3-001 - ENSP00000361073 [100%]
NCOA3-002 - ENSP00000361065 [100%]
NCOA3-003 - ENSP00000361066 [100%]
NCOA3-201 - ENSP00000342123 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells and decidual cells .
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

155.3, 154.9, 154.4, 147.5 155.3, 154.9, 154.4, 147.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
  

Antibody dilution

1:100  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NCOA3-001
 
NCOA3-002
 
NCOA3-003
 
NCOA3-201