STX16

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041019

 

Antibody HPA042033

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041019 HPA042033 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

101 68 

Antigen sequence

SPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDE
IQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFH
R
 
ACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFF
DTSVPLMDDGDDNTLYHR
 

Matching transcripts

STX16-002 - ENSP00000360183 [100%]
STX16-202 - ENSP00000354445 [99%]
STX16-010 - ENSP00000350723 [96%]
STX16-015 - ENSP00000436667 [96%]
STX16-004 - ENSP00000348229 [90%]
STX16-005 - ENSP00000432414 [90%]
STX16-001 - ENSP00000360173 [89%]
STX16-201 - ENSP00000355408 [88%]
STX16-003 - ENSP00000434369 [86%]
STX16-016 - ENSP00000312086 [81%]
STX16-018 - ENSP00000352634 [81%]
STX16-019 - ENSP00000388348 [81%]
STX16-020 - ENSP00000416852 [81%]
 STX16-001 - ENSP00000360173 [100%]
STX16-002 - ENSP00000360183 [100%]
STX16-004 - ENSP00000348229 [100%]
STX16-005 - ENSP00000432414 [100%]
STX16-010 - ENSP00000350723 [100%]
STX16-016 - ENSP00000312086 [100%]
STX16-018 - ENSP00000352634 [100%]
STX16-021 - ENSP00000401801 [100%]
STX16-201 - ENSP00000355408 [100%]
STX16-202 - ENSP00000354445 [100%]
 

Other gene match

STX16-NPEPL1 - ENSG00000254995 [100%]
 STX16-NPEPL1 - ENSG00000254995 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:139 1:56 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418449)
More information
 

Target mass (kDa)

43.2, 37.0, 36.5, 35.3, 34.8, 31.1, 23.3, 23.0, 13.9, 13.5, 13.4, 13.0 43.2, 37.0, 36.5, 35.3, 34.8, 31.1, 25.0, 23.3, 23.0 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
STX16-001
 
STX16-002
 
STX16-003
 
STX16-004
 
STX16-005
 
STX16-010
 
STX16-015
 
STX16-016
 
STX16-018
 
STX16-019
 
STX16-020
 
STX16-021
 
STX16-201
 
STX16-202
 
 »