MPHOSPH10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035059

 

Antibody HPA035060

 

Antibody HPA049907

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035059 HPA035060 HPA049907 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

94 101 21 

Antigen sequence

RLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLK
LDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLA
 
DDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSFE
KRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAV
R
 
FSDEDSDLDFDISKLEQQSKV
 

Matching transcripts

MPHOSPH10-001 - ENSP00000244230 [100%]
 MPHOSPH10-001 - ENSP00000244230 [100%]
MPHOSPH10-002 - ENSP00000475545 [100%]
 MPHOSPH10-001 - ENSP00000244230 [100%]
MPHOSPH10-002 - ENSP00000475545 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
More information
 

Antibody dilution

1:169 1:67 1:91 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

78.9 78.9, 53.6 78.9, 53.6 

Antibody dilution

1:250 1:250 1:460 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3650 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human skin shows strong nucleolar positivity in epidermal cells.
More information
  

Retrieval method

 HIER pH6  

Antibody dilution

 1:300  

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  
 

ANTIGEN VIEW

? »
 
 
 
MPHOSPH10-001
 
MPHOSPH10-002