F13A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001804

 

Antibody CAB002155

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA001804 NCL-FXIIIa 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

136  

Antigen sequence

LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDP
RRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRL
SIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
 
 

Matching transcripts

F13A1-001 - ENSP00000264870 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human corpus, uterine, shows strong cytoplasmic and nuclear positivity in a subset of cells in endometrial stroma.
More information
 Immunohistochemical staining of human vulva/anal skin shows cytoplasmic and nuclear positivity in a subset of cells in dermis.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:80 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.3 83.3, 21.0, 16.7, 16.0, 11.2 

Antibody dilution

1:250 1:5000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
F13A1-001