|
Antibody CAB012357
|
|
Antibody HPA018402
|
|
Antibody HPA023959
|
|
Antibody HPA029909
|
|
Antibody HPA029910
|
|
|
ANTIBODY INFORMATION
|
|
Provider |
Abcam plc
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
31351 | | HPA018402 | | HPA023959 | | HPA029909 | | HPA029910 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | | Rabbit | |
Clonality |
msAb | | pAb | | pAb | | pAb | | pAb | |
Purity |
Affinity | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | |
Released in version |
4.0 | | 4.0 | | 5.0 | | 6.0 | | 6.0 | |
|
ANTIGEN INFORMATION
|
|
Antigen |
Synthetic peptide | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | |
Length (aa) |
| | 130 | | 81 | | 127 | | 125 | |
Antigen sequence |
| | ILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRM
LTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDL
GKCLMKHEDVCTALLITAFNSLAWKDTLSC
| | ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVH
| | MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQIL
KLLDNLLALIRTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPL
LELNDSPVFKTVLERMQRFFSTLYENC
| | AGEWLKYQLSTFLDAGSVNSCSAVGTGEGSLCSVFSPSFVQWEAMTLFLE
SVITQMFRTLNREEIPVNDGIELLQMVLNFDTKDPLILSCVLTNVSALFP
FVTYRPEFLPQVFSKLFSSVTFETV
| |
Matching transcripts |
| | XPO5-001 - ENSP00000265351 [100%] XPO5-015 - ENSP00000387384 [92%]
| | XPO5-001 - ENSP00000265351 [100%]
| | XPO5-001 - ENSP00000265351 [100%]
| | XPO5-001 - ENSP00000265351 [100%]
| |
Other gene match |
| | | | | | | | | |
|
ANTIBODY VALIDATION
|
|
|
Immunohistochemistry
|
|
Image |
 | |  | |  | |  | |  | |
Description |
Immunohistochemical staining of human kidney shows granular cytoplasmic positivity in cells in tubules. More information | | Immunohistochemical staining of human testis shows strong positivity in seminiferus ducts. More information | | Immunohistochemical staining of human testis shows distinct nuclear and cytoplasmic positivity in germ cells. More information | | Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subsets of cells outside the germinal center. More information | | Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:100 | | 1:250 | | 1:50 | | 1:250 | | 1:35 | |
Validation |
|
Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data |
| |
|
Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data |
| |
|
Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data |
| |
|
Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data |
| |
|
Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data |
| |
|
Immunofluorescence
|
|
Image |
 | |  | |  | |  | |  | |
Description |
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli. More information | |
Antibody dilution |
1:25 | | 1:54 | | 1:50 | | 1:50 | | 1:20 | |
Validation |
|
The subcellular location is supported by literature. |
| |
|
The subcellular location is supported by literature. |
| |
|
The subcellular location is supported by literature. |
| |
|
The subcellular location is supported by literature. |
| |
|
The subcellular location is supported by literature. |
| |
|
Western Blot
|
|
Image |
 | |  | |  | |  | |  | |
Description |
Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
136.3, 28.3, 12.1, 8.7, 7.0, 2.4 | | 136.3, 28.3 | | 136.3 | | 136.3 | | 136.3 | |
Antibody dilution |
1:500 | | 1:250 | | 1:250 | | 1:250 | | 1:250 | |
Validation |
|
Band of predicted size in kDa (+/-20%) with additional bands present |
| |
|
Band of predicted size in kDa (+/-20%) with additional bands present |
| |
|
Single band corresponding to the predicted size in kDa (+/-20%) |
| |
|
Band of predicted size in kDa (+/-20%) with additional bands present |
| |
| |
|
Protein array
|
|
Image |
| |  | |  | |  | |  | |
Description |
| | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | |
Antibody dilution |
| | 1:3000 | | 1:3000 | | 1:3000 | | 1:3000 | |
Validation |
| |
|
Pass with single peak corresponding to interaction only with its own antigen. |
| |
|
Pass with single peak corresponding to interaction only with its own antigen. |
| |
|
Pass with single peak corresponding to interaction only with its own antigen. |
| |
|
Pass with single peak corresponding to interaction only with its own antigen. |
| |
| |