LRRFIP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006979

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA006979 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

149 

Antigen sequence

KTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKEPDEEKSDQQGEALDS
SQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNTDLSEIKEEEQVKST
DRKSAVEAQNEVTENPKQKIAAESSENVDCPENPKIKLDGKLDQEGDDV
 

Matching transcripts

LRRFIP1-001 - ENSP00000244815 [100%]
LRRFIP1-003 - ENSP00000375857 [100%]
LRRFIP1-004 - ENSP00000289175 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:22 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

89.3, 86.4, 82.7 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LRRFIP1-001
 
LRRFIP1-003
 
LRRFIP1-004